Search results

From DrugPedia: A Wikipedia for Drug discovery

No page title matches

There is no page titled "IEDB.pdf". You can create this page.

For more information about searching DrugPedia: A Wikipedia for Drug discovery, see Help.

Showing below up to 20 results starting with #1.

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Page text matches

• Immunotation of Rv2753c (dihydrodipicolinate synthase)
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  4 KB (531 words) - 09:54, 5 January 2010
• Guideline for creating Immunotation of Mtb
  12. Go to [http://www.iedb.org/ IEDB database ], paste Locus name in the 'keyword search' box at the top right ... c) Go to site [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB] and paste sequence in raw format, select 'Bepipred Linear Epitope Predict ...
  7 KB (1131 words) - 06:11, 15 January 2010
• Immunotation of Rv0084
  No. Hit Found in [http://www.iedb.org/ IEDB] ... /crdd.osdd.net/drugpedia/index.php/Image:BcePred_Prediction_Serverresults1.pdf]<br>
  4 KB (629 words) - 18:59, 14 February 2010
• Immunotation of Rv0342
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/0342_%281%29.pdf]<br>
  5 KB (694 words) - 08:20, 31 January 2010
• Immunotation of rv1980c
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv1980.pdf]<br>
  5 KB (683 words) - 08:06, 26 January 2010
• Immunotation of Rv0667
  No. Hit Found in [http://www.iedb.org/ IEDB] ====IEDB Analysis====
  5 KB (577 words) - 18:14, 29 January 2010
• Immunotation of Rv2754c
  No. Hit Found in [http://www.iedb.org/ IEDB] ... ed by [http://crdd.osdd.net/drugpedia/images/Http_www.imtech.res.in_cg....pdf]<br>
  4 KB (512 words) - 19:29, 26 January 2010
• Immunoatation of Rv2711
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/Amit.pdf]<br>
  4 KB (623 words) - 09:56, 26 January 2010
• Immunoatation of Rv2031c
  result predicted by IEDB [http://crdd.osdd.net/drugpedia/images/Amit.pdf]<br> Result Predicited by [http://crdd.osdd.net/drugpedia/images/Amit_1.pdf]<br>
  5 KB (758 words) - 07:59, 27 January 2010
• Immunotation of Rv0015c
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  4 KB (527 words) - 18:13, 29 January 2010
• Immunotation of Rv0016c
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/K1.pdf]<br>
  5 KB (698 words) - 08:44, 1 February 2010
• Immunitation of Rv2220
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/2220.pdf]<br>
  5 KB (647 words) - 08:27, 31 January 2010
• Immunotation of Rv3340
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/A111.pdf]<br>
  4 KB (514 words) - 08:16, 1 February 2010
• Immunotatin of Rv3151
  result predicted by[http://crdd.osdd.net/drugpedia/images/Algpred_Out.pdf] No. Hit Found in [http://www.iedb.org/ IEDB]
  5 KB (655 words) - 08:36, 1 February 2010
• Imunoatation of Rv0007
  No. Hit Found in [http://www.iedb.org/ IEDB] Result Predicited by [http://crdd.osdd.net/drugpedia/images/BcePred.pdf]<br>
  4 KB (499 words) - 07:15, 2 February 2010
• Immunotation of Rv3921c
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  4 KB (511 words) - 06:54, 2 February 2010
• Immunotation of Rv3918c
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  4 KB (538 words) - 07:59, 2 February 2010
• Immunotation of Rv3608C
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  4 KB (543 words) - 08:32, 2 February 2010
• Immunotation of Rv3596c
  No. Hit Found in [http://www.iedb.org/ IEDB] ... esult Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
  5 KB (613 words) - 08:13, 3 February 2010
• Immunoatation of Rv2992c
  PDDDLAWNDLVRGPVTFAAGSVPDFALTRASGDPLYTLVNPCDDALMKITHVLRGEDLLPSTPRQLALHQALIRIGVAER No. Hit Found in [http://www.iedb.org/ IEDB]
  4 KB (469 words) - 11:56, 2 February 2010

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)