Immunotation of Rv3608C
From DrugPedia: A Wikipedia for Drug discovery
| Immunotation of Rv3608C
| |
| Name | |
| <Rv3608c> dihydropteroate synthase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 28842.7 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.94 |
Contents |
[edit] General
Rv3608c, (MTCY07H7B.14), folP, len: 280. Dihydropteroate synthase, similar to e.g. DHPS_ECOLI P26282 dihydropteroate synthase (ec 2.5.1.15 SECOND STEP IN DIHYDROFOLATE BIOSYNTHESIS(282 aa), fasta scores, opt:642, E(): 0, (42.0%identity in 274 aa overlap); contains PS00792 Dihydropteroate synthase signature 1, PS00793 Dihydropteroate synthase signature 2. Updated info: Functional Category: intermediary metabolism and respiration. EC:2.5.1.15 Dihydropteroate synthetase is an enzyme classified under EC 2.5.1.15. It produces dihydropteroate in bacteria, but does not function in humans. This makes it a useful target for sulfonamide antibiotics, which compete with the PABA precursor.
It acts upon 4-Aminobenzoic acid (PABA} and dihydropteridine-hydroxymethyl-pyrophosphate.
[edit] Protein Sequence
>Rv3608c, TB.seq 4049138:4049977 MW:28812 VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSRVIPVVKELAAQG ITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLAS VADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8IWV2 | 37 | 52 | 51 | 2.4 |
| sp|Q5T9C9 | 40 | 62 | 35 | 5.9 |
| sp|Q8N3K9 | 22 | 39 | 117 | 7.0 |
| sp|Q86XD8 | 40 | 60 | 25 | 9.2 |
| sp|P52732 | 28 | 45 | 66 | 9.9 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
cytoplasmic protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
