From DrugPedia: A Wikipedia for Drug discovery

Imunoatation of Rv0007
Name
POSSIBLE CONSERVED MEMBRANE PROTEIN
Identifiers
Swiss Prot	P71575
Genbank	885982
PDB	?
Chemical data
Formula	C12H10BrNOS2 [1]
Mol. wt.	31073 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	9.17

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Hypothetical protein, No PDB structure available, Possible conserved membrane protein and highly similar to the Z70722|MLCB1770_7 Mycobacterium leprae cosmid B1770 (303 aa), FASTA scores: opt: 812, E(): 1.6e-25, (54.2% identity in 319 aa overlap). Non essential for optimal growth.(http://www.biohealthbase.org/brc/details.do?locus=Rv0007&decorator=mycobacterium)

[edit] Protein Sequence

>Rv0007, TB.seq 9914:10825 MW:31042 VTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADA RLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAG SSGGRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNV GDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTLADRD

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
|sp|Q9Y4K1.3	26	32	176	0.061
sp|O75962.2	27	33	151	0.067
sp|Q13029.3	29	39	89	0.13
sp|Q9Y6V0.3	25	35	120	0.28
sp|Q6IQ32.1	27	40	86	0.46

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]<

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]<

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.