From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv3608C
Name
<Rv3608c> dihydropteroate synthase
Identifiers
Swiss Prot	P0A578
Genbank	?
PDB	1EYE
Chemical data
Formula	?
Mol. wt.	28842.7
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.94

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Rv3608c, (MTCY07H7B.14), folP, len: 280. Dihydropteroate synthase, similar to e.g. DHPS_ECOLI P26282 dihydropteroate synthase (ec 2.5.1.15 SECOND STEP IN DIHYDROFOLATE BIOSYNTHESIS(282 aa), fasta scores, opt:642, E(): 0, (42.0%identity in 274 aa overlap); contains PS00792 Dihydropteroate synthase signature 1, PS00793 Dihydropteroate synthase signature 2. Updated info: Functional Category: intermediary metabolism and respiration. EC:2.5.1.15 Dihydropteroate synthetase is an enzyme classified under EC 2.5.1.15. It produces dihydropteroate in bacteria, but does not function in humans. This makes it a useful target for sulfonamide antibiotics, which compete with the PABA precursor.

It acts upon 4-Aminobenzoic acid (PABA} and dihydropteridine-hydroxymethyl-pyrophosphate.

[edit] Protein Sequence

>Rv3608c, TB.seq 4049138:4049977 MW:28812 VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSRVIPVVKELAAQG ITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLAS VADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q8IWV2	37	52	51	2.4
sp|Q5T9C9	40	62	35	5.9
sp|Q8N3K9	22	39	117	7.0
sp|Q86XD8	40	60	25	9.2
sp|P52732	28	45	66	9.9

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
cytoplasmic protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.