Rv0285
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
Nitinkumar (Talk | contribs)
(New page: {{immunebox | Name =<b> PE5 </b> |image= | width=250 |image2= |Swiss Prot = Q7DA36 | Genbank = 886608 | PDB = | DrugBank = | chemical_formula = C1...)
Next diff →
Revision as of 10:33, 4 February 2010
Rv0285
| |
Name | |
PE5 | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | C15H13NO5 [1] |
Mol. wt. | 9566 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.19 |
Contents |
General
Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.
Protein Sequence
>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9NWV4.1 | 29 | 48 | 54 | 0.17 |
sp|Q38SD2.2 | 27 | 38 | 76 | 1.7 |
sp|Q8WUY3.2 | 27 | 46 | 47 | 5.9 |
sp|Q504Y2.1 | 35 | 50 | 48 | 7.2 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Integral Membrane
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by
ABCpred Analysis
Link to ABCpred
Result Predicited by
IEDB Analysis
Link to IEDB
Result Predicited by
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by
IEDB Analysis
Link to IEDB
Result Predicted by
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.