Rv0285
From DrugPedia: A Wikipedia for Drug discovery
| Rv0285
| |
| Name | |
| PE5 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | C15H13NO5 [1] |
| Mol. wt. | 9566 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.19 |
Contents |
[edit] General
Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.
[edit] Protein Sequence
>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9NWV4.1 | 29 | 48 | 54 | 0.17 |
| sp|Q38SD2.2 | 27 | 38 | 76 | 1.7 |
| sp|Q8WUY3.2 | 27 | 46 | 47 | 5.9 |
| sp|Q504Y2.1 | 35 | 50 | 48 | 7.2 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by
[8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
