Rv0285
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(→Subcellular Location) |
|||
| Line 58: | Line 58: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R0285.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02851.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02852.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
| Line 72: | Line 72: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02853.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| Line 80: | Line 80: | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/R02855.pdf]<br> |
| Line 86: | Line 86: | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
Result Predicted by | Result Predicted by | ||
| - | + | [http://crdd.osdd.net/drugpedia/images/R02856.pdf]<br> | |
=External Links= | =External Links= | ||
* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
Revision as of 11:38, 4 February 2010
| Rv0285
| |
| Name | |
| PE5 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C15H13NO5 [1] |
| Mol. wt. | 9566 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.19 |
Contents |
General
Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.
Protein Sequence
>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9NWV4.1 | 29 | 48 | 54 | 0.17 |
| sp|Q38SD2.2 | 27 | 38 | 76 | 1.7 |
| sp|Q8WUY3.2 | 27 | 46 | 47 | 5.9 |
| sp|Q504Y2.1 | 35 | 50 | 48 | 7.2 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cytoplasmic
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
IEDB Analysis
Link to IEDB
Result Predicited by [4]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
IEDB Analysis
Link to IEDB
Result Predicted by
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [6]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by
[7]
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
