From DrugPedia: A Wikipedia for Drug discovery

Revision as of 10:33, 4 February 2010 (edit) Nitinkumar (Talk | contribs) (New page: {{immunebox | Name =<b> PE5 </b> |image= | width=250 |image2= |Swiss Prot = Q7DA36 | Genbank = 886608 | PDB = | DrugBank = | chemical_formula = C1...) ← Previous diff		Revision as of 10:38, 4 February 2010 (edit) (undo) Nitinkumar (Talk | contribs) (→Subcellular Location) Next diff →
Line 48:		Line 48:
	=Subcellular Location=		=Subcellular Location=
	Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>		Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
-	Integral Membrane	+	Cytoplasmic
	=Antigens=		=Antigens=

---

Revision as of 10:38, 4 February 2010

Rv0285
Name
PE5
Identifiers
Swiss Prot	Q7DA36
Genbank	886608
PDB	?
Chemical data
Formula	C15H13NO5 [1]
Mol. wt.	9566 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.19

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.

Protein Sequence

>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9NWV4.1	29	48	54	0.17
sp|Q38SD2.2	27	38	76	1.7
sp|Q8WUY3.2	27	46	47	5.9
sp|Q504Y2.1	35	50	48	7.2

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cytoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by

ABCpred Analysis

Link to ABCpred
Result Predicited by

IEDB Analysis

Link to IEDB
Result Predicited by

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by

IEDB Analysis

Link to IEDB
Result Predicted by

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.