Immunotation of Rv3608C
From DrugPedia: A Wikipedia for Drug discovery
(→IEDB Analysis) |
(→Propred Analysis) |
||
| Line 81: | Line 81: | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Dd3.txt] |
| - | + | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Revision as of 08:30, 2 February 2010
| Immunotation of Rv3608C
| |
| Name | |
| <Rv3608c> dihydropteroate synthase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 28842.7 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.94 |
Contents |
General
Rv3608c, (MTCY07H7B.14), folP, len: 280. Dihydropteroate synthase, similar to e.g. DHPS_ECOLI P26282 dihydropteroate synthase (ec 2.5.1.15 SECOND STEP IN DIHYDROFOLATE BIOSYNTHESIS(282 aa), fasta scores, opt:642, E(): 0, (42.0%identity in 274 aa overlap); contains PS00792 Dihydropteroate synthase signature 1, PS00793 Dihydropteroate synthase signature 2. Updated info: Functional Category: intermediary metabolism and respiration. EC:2.5.1.15 Dihydropteroate synthetase is an enzyme classified under EC 2.5.1.15. It produces dihydropteroate in bacteria, but does not function in humans. This makes it a useful target for sulfonamide antibiotics, which compete with the PABA precursor.
It acts upon 4-Aminobenzoic acid (PABA} and dihydropteridine-hydroxymethyl-pyrophosphate.
Protein Sequence
>Rv3608c, TB.seq 4049138:4049977 MW:28812 VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSRVIPVVKELAAQG ITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLAS VADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8IWV2 | 37 | 52 | 51 | 2.4 |
| sp|Q5T9C9 | 40 | 62 | 35 | 5.9 |
| sp|Q8N3K9 | 22 | 39 | 117 | 7.0 |
| sp|Q86XD8 | 40 | 60 | 25 | 9.2 |
| sp|P52732 | 28 | 45 | 66 | 9.9 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
cytoplasmic protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
IEDB Analysis
Link to IEDB
Result Predicited by IEDB
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
IEDB Analysis
Link to IEDB
Result Predicted by [2]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [3]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by []
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
