Immunotation of Rv3608C
From DrugPedia: A Wikipedia for Drug discovery
Line 41: | Line 41: | ||
<tr><td> sp|P52732</td><td> 28</td><td> 45</td><td> 66</td><td> 9.9</td></tr></table> | <tr><td> sp|P52732</td><td> 28</td><td> 45</td><td> 66</td><td> 9.9</td></tr></table> | ||
+ | =Alergen Protein= | ||
+ | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
+ | Non Allergen Predicted by AlgPred Server | ||
+ | =Bacterial Toxin Prediction= | ||
+ | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
+ | No Hit Fountd by btxpred server. | ||
+ | =Subcellular Location= | ||
+ | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
+ | cytoplasmic protein |
Revision as of 08:21, 2 February 2010
Immunotation of Rv3608C
| |
Name | |
<Rv3608c> dihydropteroate synthase | |
Identifiers | |
Swiss Prot | |
Genbank | ? |
PDB | |
Chemical data | |
Formula | ? |
Mol. wt. | 28842.7 |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.94 |
Contents |
General
Rv3608c, (MTCY07H7B.14), folP, len: 280. Dihydropteroate synthase, similar to e.g. DHPS_ECOLI P26282 dihydropteroate synthase (ec 2.5.1.15 SECOND STEP IN DIHYDROFOLATE BIOSYNTHESIS(282 aa), fasta scores, opt:642, E(): 0, (42.0%identity in 274 aa overlap); contains PS00792 Dihydropteroate synthase signature 1, PS00793 Dihydropteroate synthase signature 2. Updated info: Functional Category: intermediary metabolism and respiration. EC:2.5.1.15 Dihydropteroate synthetase is an enzyme classified under EC 2.5.1.15. It produces dihydropteroate in bacteria, but does not function in humans. This makes it a useful target for sulfonamide antibiotics, which compete with the PABA precursor.
It acts upon 4-Aminobenzoic acid (PABA} and dihydropteridine-hydroxymethyl-pyrophosphate.
Protein Sequence
>Rv3608c, TB.seq 4049138:4049977 MW:28812 VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSRVIPVVKELAAQG ITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLAS VADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q8IWV2 | 37 | 52 | 51 | 2.4 |
sp|Q5T9C9 | 40 | 62 | 35 | 5.9 |
sp|Q8N3K9 | 22 | 39 | 117 | 7.0 |
sp|Q86XD8 | 40 | 60 | 25 | 9.2 |
sp|P52732 | 28 | 45 | 66 | 9.9 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
cytoplasmic protein