Imunoatation of Rv0007
From DrugPedia: A Wikipedia for Drug discovery
| Line 58: | Line 58: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred.pdf Bcepred]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Revision as of 06:27, 2 February 2010
| Imunoatation of Rv0007
| |
| Name | |
| POSSIBLE CONSERVED MEMBRANE PROTEIN | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C12H10BrNOS2 [1] |
| Mol. wt. | 31073 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.17 |
Contents |
General
Hypothetical protein, Possible conserved membrane protein and highly similar to the Z70722|MLCB1770_7 Mycobacterium leprae cosmid B1770 (303 aa), FASTA scores: opt: 812, E(): 1.6e-25, (54.2% identity in 319 aa overlap). Non essential for optimal growth.(http://www.biohealthbase.org/brc/details.do?locus=Rv0007&decorator=mycobacterium)
Protein Sequence
>Rv0007, TB.seq 9914:10825 MW:31042 VTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADA RLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAG SSGGRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNV GDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTLADRD
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| |sp|Q9Y4K1.3 | 26 | 32 | 176 | 0.061 |
| sp|O75962.2 | 27 | 33 | 151 | 0.067 |
| sp|Q13029.3 | 29 | 39 | 89 | 0.13 |
| sp|Q9Y6V0.3 | 25 | 35 | 120 | 0.28 |
| sp|Q6IQ32.1 | 27 | 40 | 86 | 0.46 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Integral Membrane
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicited by
IEDB Analysis
Link to IEDB
Result Predicited by
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by
IEDB Analysis
Link to IEDB
Result Predicted by
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
