Rv0285

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(Subcellular Location)
Current revision (13:40, 4 February 2010) (edit) (undo)
 
(2 intermediate revisions not shown.)
Line 6: Line 6:
|Swiss Prot =  Q7DA36  
|Swiss Prot =  Q7DA36  
| Genbank          = 886608
| Genbank          = 886608
-
| PDB        =
+
| PDB        = none
| DrugBank          =
| DrugBank          =
| chemical_formula  = C15H13NO5    [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886608&loc=ec_rcs]
| chemical_formula  = C15H13NO5    [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886608&loc=ec_rcs]
Line 58: Line 58:
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]   
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]   
<br>
<br>
-
Result Predicited by
+
Result Predicited by [http://crdd.osdd.net/drugpedia/images/R0285.pdf]<br>
====ABCpred Analysis====
====ABCpred Analysis====
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
-
Result Predicited by
+
Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02851.pdf]<br>
====IEDB Analysis====
====IEDB Analysis====
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
-
Result Predicited by
+
Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02852.pdf]<br>
=MHC Class-I Binder=
=MHC Class-I Binder=
Line 72: Line 72:
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
<br>  
<br>  
-
Result Predicited by   
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/R02853.pdf]<br>
==IEDB Analysis==
==IEDB Analysis==
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
-
Result Predicted by  
+
Result Predicted by [http://crdd.osdd.net/drugpedia/images/R02854.pdf]<br>
=MHC Class-II Binder=
=MHC Class-II Binder=
==Propred Analysis==
==Propred Analysis==
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
-
Result Predicted by  
+
Result Predicted by [http://crdd.osdd.net/drugpedia/images/R02855.pdf]<br>
Line 86: Line 86:
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
Result Predicted by  
Result Predicted by  
-
 
+
[http://crdd.osdd.net/drugpedia/images/R02856.pdf]<br>
=External Links=
=External Links=
* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.
* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.

Current revision

Rv0285
Name
PE5
Identifiers
Swiss Prot Q7DA36
Genbank 886608
PDB none
Chemical data
Formula C15H13NO5 [1]
Mol. wt. 9566 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 4.19

Contents

[edit] General

Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.

[edit] Protein Sequence

>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG



[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q9NWV4.1 29 48 54 0.17
sp|Q38SD2.2 27 38 76 1.7
sp|Q8WUY3.2 27 46 47 5.9
sp|Q504Y2.1 35 50 48 7.2

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.