Rv0285
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(New page: {{immunebox | Name =<b> PE5 </b> |image= | width=250 |image2= |Swiss Prot = Q7DA36 | Genbank = 886608 | PDB = | DrugBank = | chemical_formula = C1...) |
|||
| (3 intermediate revisions not shown.) | |||
| Line 6: | Line 6: | ||
|Swiss Prot = Q7DA36 | |Swiss Prot = Q7DA36 | ||
| Genbank = 886608 | | Genbank = 886608 | ||
| - | | PDB = | + | | PDB = none |
| DrugBank = | | DrugBank = | ||
| chemical_formula = C15H13NO5 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886608&loc=ec_rcs] | | chemical_formula = C15H13NO5 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886608&loc=ec_rcs] | ||
| Line 48: | Line 48: | ||
=Subcellular Location= | =Subcellular Location= | ||
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| - | + | Cytoplasmic | |
=Antigens= | =Antigens= | ||
| Line 58: | Line 58: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R0285.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02851.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02852.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
| Line 72: | Line 72: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/R02853.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/R02854.pdf]<br> |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/R02855.pdf]<br> |
| Line 86: | Line 86: | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
Result Predicted by | Result Predicted by | ||
| - | + | [http://crdd.osdd.net/drugpedia/images/R02856.pdf]<br> | |
=External Links= | =External Links= | ||
* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
Current revision
| Rv0285
| |
| Name | |
| PE5 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | C15H13NO5 [1] |
| Mol. wt. | 9566 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.19 |
Contents |
[edit] General
Member of the Mycobacterium tuberculosis PE family, Essential for optimal growth.
[edit] Protein Sequence
>Rv0285, TB.seq 349622:349927 MW:9566 MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVG ESGASYLAGDAAAAATYGVVGG
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9NWV4.1 | 29 | 48 | 54 | 0.17 |
| sp|Q38SD2.2 | 27 | 38 | 76 | 1.7 |
| sp|Q8WUY3.2 | 27 | 46 | 47 | 5.9 |
| sp|Q504Y2.1 | 35 | 50 | 48 | 7.2 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by
[8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
