Immunotation of Rv3608C

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(nHLAPred Analysis)
Current revision (08:32, 2 February 2010) (edit) (undo)
(NetMHC-II Analysis)
 
(2 intermediate revisions not shown.)
Line 76: Line 76:
==IEDB Analysis==
==IEDB Analysis==
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Dd2.txt]
=MHC Class-II Binder=
=MHC Class-II Binder=
==Propred Analysis==
==Propred Analysis==
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Dd3.txt]
-
 
+
==NetMHC-II Analysis==
==NetMHC-II Analysis==
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Dd4.txt]
=External Links=
=External Links=

Current revision

Immunotation of Rv3608C
Name
<Rv3608c> dihydropteroate synthase
Identifiers
Swiss Prot P0A578
Genbank  ?
PDB 1EYE
Chemical data
Formula  ?
Mol. wt. 28842.7
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 4.94

Contents

[edit] General

Rv3608c, (MTCY07H7B.14), folP, len: 280. Dihydropteroate synthase, similar to e.g. DHPS_ECOLI P26282 dihydropteroate synthase (ec 2.5.1.15 SECOND STEP IN DIHYDROFOLATE BIOSYNTHESIS(282 aa), fasta scores, opt:642, E(): 0, (42.0%identity in 274 aa overlap); contains PS00792 Dihydropteroate synthase signature 1, PS00793 Dihydropteroate synthase signature 2. Updated info: Functional Category: intermediary metabolism and respiration. EC:2.5.1.15 Dihydropteroate synthetase is an enzyme classified under EC 2.5.1.15. It produces dihydropteroate in bacteria, but does not function in humans. This makes it a useful target for sulfonamide antibiotics, which compete with the PABA precursor.

It acts upon 4-Aminobenzoic acid (PABA} and dihydropteridine-hydroxymethyl-pyrophosphate.

[edit] Protein Sequence

>Rv3608c, TB.seq 4049138:4049977 MW:28812 VSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSRVIPVVKELAAQG ITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLAS VADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q8IWV2 37 52 51 2.4
sp|Q5T9C9 40 62 35 5.9
sp|Q8N3K9 22 39 117 7.0
sp|Q86XD8 40 60 25 9.2
sp|P52732 28 45 66 9.9

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
cytoplasmic protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.