From DrugPedia: A Wikipedia for Drug discovery

Revision as of 10:06, 3 February 2010 (edit) Priyanka priyadarshini (Talk | contribs) ← Previous diff		Current revision (05:31, 23 February 2010) (edit) (undo) Priyanka priyadarshini (Talk | contribs) (→General)
(One intermediate revision not shown.)
Line 14:		Line 14:
	}}		}}
	=General=		=General=
		+	Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan
		+
		+	L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O
		+	It has two functional domains, each found in bacteria and plants on a separate subunit.
	==Protein Sequence==		==Protein Sequence==
	>Rv1613, TB.seq  1812357:1813166 MW:27728		>Rv1613, TB.seq  1812357:1813166 MW:27728
Line 21:		Line 25:
	ALVTALTEGLPRLRALTGELAAGVRLGMSA		ALVTALTEGLPRLRALTGELAAGVRLGMSA
	*		*
		+
	=Human Homologue Blast Result=		=Human Homologue Blast Result=

---

Current revision

Immunotation of Rv1613c
Name
<Rv1613>Tryptophan synthase alpha chain
Identifiers
Swiss Prot	P66980
Genbank	?
PDB	none
Chemical data
Formula	?
Mol. wt.	27728 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.6768

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan

L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O It has two functional domains, each found in bacteria and plants on a separate subunit.

[edit] Protein Sequence

>Rv1613, TB.seq 1812357:1813166 MW:27728 MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAAL RGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLV APSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS ALVTALTEGLPRLRALTGELAAGVRLGMSA

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9Y4E6	29	40	125	0.008
sp|Q8IX03	32	42	87	2.4
sp|Q8NEL9	31	42	87	2.5
sp|P11532	26	42	109	4.4
sp|Q8IYB8	30	61	26	4.9

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
INTEGRAL MEMBRANE PROTEIN

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.