Immunotation of Rv1613c
From DrugPedia: A Wikipedia for Drug discovery
Immunotation of Rv1613c
| |
Name | |
<Rv1613>Tryptophan synthase alpha chain | |
Identifiers | |
Swiss Prot | |
Genbank | ? |
PDB | |
Chemical data | |
Formula | ? |
Mol. wt. | 27728 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.6768 |
Contents |
[edit] General
Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan
L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O It has two functional domains, each found in bacteria and plants on a separate subunit.
[edit] Protein Sequence
>Rv1613, TB.seq 1812357:1813166 MW:27728 MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAAL RGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLV APSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS ALVTALTEGLPRLRALTGELAAGVRLGMSA
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9Y4E6 | 29 | 40 | 125 | 0.008 |
sp|Q8IX03 | 32 | 42 | 87 | 2.4 |
sp|Q8NEL9 | 31 | 42 | 87 | 2.5 |
sp|P11532 | 26 | 42 | 109 | 4.4 |
sp|Q8IYB8 | 30 | 61 | 26 | 4.9 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
INTEGRAL MEMBRANE PROTEIN
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.