From DrugPedia: A Wikipedia for Drug discovery

Revision as of 10:06, 3 February 2010 (edit) Priyanka priyadarshini (Talk | contribs) ← Previous diff		Revision as of 05:30, 23 February 2010 (edit) (undo) Priyanka priyadarshini (Talk | contribs) (→General) Next diff →
Line 14:		Line 14:
	}}		}}
	=General=		=General=
		+	Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan
		+
		+	L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O
		+	It has two functional domains, each found in bacteria and plants on a separate subunit. I
	==Protein Sequence==		==Protein Sequence==
	>Rv1613, TB.seq  1812357:1813166 MW:27728		>Rv1613, TB.seq  1812357:1813166 MW:27728
Line 21:		Line 25:
	ALVTALTEGLPRLRALTGELAAGVRLGMSA		ALVTALTEGLPRLRALTGELAAGVRLGMSA
	*		*
		+
	=Human Homologue Blast Result=		=Human Homologue Blast Result=

---

Revision as of 05:30, 23 February 2010

Immunotation of Rv1613c
Name
<Rv1613>Tryptophan synthase alpha chain
Identifiers
Swiss Prot	P66980
Genbank	?
PDB	none
Chemical data
Formula	?
Mol. wt.	27728 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.6768

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan

L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O It has two functional domains, each found in bacteria and plants on a separate subunit. I

Protein Sequence

>Rv1613, TB.seq 1812357:1813166 MW:27728 MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAAL RGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLV APSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS ALVTALTEGLPRLRALTGELAAGVRLGMSA

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9Y4E6	29	40	125	0.008
sp|Q8IX03	32	42	87	2.4
sp|Q8NEL9	31	42	87	2.5
sp|P11532	26	42	109	4.4
sp|Q8IYB8	30	61	26	4.9

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
INTEGRAL MEMBRANE PROTEIN

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

IEDB Analysis

Link to IEDB
Result Predicited by IEDB

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

IEDB Analysis

Link to IEDB
Result Predicted by [2]

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by [3]

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.