. Immunotation of Rv3901c
From DrugPedia: A Wikipedia for Drug discovery
(→General) |
|||
Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
+ | Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: | ||
+ | Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins | ||
==Protein Sequence== | ==Protein Sequence== |
Current revision
. Immunotation of Rv3901c
| |
Name | |
<Rv3901c> Rv3901c membrane protein | |
Identifiers | |
Swiss Prot | |
Genbank | ? |
PDB | |
Chemical data | |
Formula | ? |
Mol. wt. | 15462.2 |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 9.35 |
Contents |
[edit] General
Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins
[edit] Protein Sequence
>Rv3901c, TB.seq 4386365:4386811 MW:15431 VQAANRRSADTICGVTAPAPLPIPRTRSWPAIVVAAIAAVVAVAALIVALTNARPAATPATTSVPTYTAAQTAAAQRQLC DTYKLVAHAVPVDTNGSDKALARITLTNAAAILDNAAADPALDAKHRDAARASDRLPHNDRNGEWWHSS
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q99607 | 27 | 46 | 69 | 2.5 |
sp|Q9Y2V2 | 29 | 42 | 57 | 4.6 |
sp|P14410 | 41 | 53 | 43 | 5.2 |
sp|P08912 | 38 | 65 | 26 | 5.4 |
sp|Q9Y5Z7 | 30 | 45 | 40 | 6.8 |