From DrugPedia: A Wikipedia for Drug discovery

. Immunotation of Rv3901c
Name
<Rv3901c> Rv3901c membrane protein
Identifiers
Swiss Prot	O05444
Genbank	?
PDB	none
Chemical data
Formula	?
Mol. wt.	15462.2
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	9.35

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins

[edit] Protein Sequence

>Rv3901c, TB.seq 4386365:4386811 MW:15431 VQAANRRSADTICGVTAPAPLPIPRTRSWPAIVVAAIAAVVAVAALIVALTNARPAATPATTSVPTYTAAQTAAAQRQLC DTYKLVAHAVPVDTNGSDKALARITLTNAAAILDNAAADPALDAKHRDAARASDRLPHNDRNGEWWHSS

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q99607	27	46	69	2.5
sp|Q9Y2V2	29	42	57	4.6
sp|P14410	41	53	43	5.2
sp|P08912	38	65	26	5.4
sp|Q9Y5Z7	30	45	40	6.8

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
PROTEIN ATTACHED TO MEMBRANE BY LIPID ANCHOR

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.