. Immunotation of Rv3901c
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(New page: {{immunebox | Name =<Rv3901c> Rv3901c membrane protein |image= | width=250 |image2= |Swiss Prot = O05444 | Genbank = | PDB = none | DrugBank = | chemi...) |
(→General) |
||
| (2 intermediate revisions not shown.) | |||
| Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
| + | Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: | ||
| + | Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins | ||
==Protein Sequence== | ==Protein Sequence== | ||
| Line 27: | Line 29: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td> sp|Q99607</td><td> 27</td><td> 46</td><td> 69</td><td> 2.5</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9Y2V2</td><td> 29</td><td> 42</td><td> 57</td><td> 4.6</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P14410</td><td> 41</td><td> 53</td><td> 43</td><td> 5.2</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P08912</td><td> 38</td><td> 65</td><td> 26</td><td> 5.4</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr></table> | + | <tr><td> sp|Q9Y5Z7</td><td> 30</td><td> 45</td><td> 40</td><td> 6.8</td></tr></table> |
| + | <table border='1'><tr> | ||
| + | |||
| + | |||
| + | =Alergen Protein= | ||
| + | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
| + | Non Allergen Predicted by AlgPred Server | ||
| + | =Bacterial Toxin Prediction= | ||
| + | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
| + | No Hit Fountd by btxpred server. | ||
| + | =Subcellular Location= | ||
| + | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| + | PROTEIN ATTACHED TO MEMBRANE BY LIPID ANCHOR | ||
| + | |||
| + | =Antigens= | ||
| + | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| + | No. Hit Found in [http://www.iedb.org/ IEDB] | ||
| + | ==B cell Epitopes== | ||
| + | ====BCEpred Analysis==== | ||
| + | |||
| + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br> | ||
| + | |||
| + | ====ABCpred Analysis==== | ||
| + | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> | ||
| + | |||
| + | ====IEDB Analysis==== | ||
| + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> | ||
| + | |||
| + | =MHC Class-I Binder= | ||
| + | ==nHLAPred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:Mm1.txt]<br> | ||
| + | ==IEDB Analysis== | ||
| + | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Mm2.txt] | ||
| + | |||
| + | =MHC Class-II Binder= | ||
| + | ==Propred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Mm3.txt] | ||
| + | |||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Mm4.txt] | ||
| + | |||
| + | =External Links= | ||
| + | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
| . Immunotation of Rv3901c
| |
| Name | |
| <Rv3901c> Rv3901c membrane protein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 15462.2 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.35 |
Contents |
[edit] General
Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins
[edit] Protein Sequence
>Rv3901c, TB.seq 4386365:4386811 MW:15431 VQAANRRSADTICGVTAPAPLPIPRTRSWPAIVVAAIAAVVAVAALIVALTNARPAATPATTSVPTYTAAQTAAAQRQLC DTYKLVAHAVPVDTNGSDKALARITLTNAAAILDNAAADPALDAKHRDAARASDRLPHNDRNGEWWHSS
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q99607 | 27 | 46 | 69 | 2.5 |
| sp|Q9Y2V2 | 29 | 42 | 57 | 4.6 |
| sp|P14410 | 41 | 53 | 43 | 5.2 |
| sp|P08912 | 38 | 65 | 26 | 5.4 |
| sp|Q9Y5Z7 | 30 | 45 | 40 | 6.8 |
