Imunoatation of Rv0007
From DrugPedia: A Wikipedia for Drug discovery
| Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
| - | Hypothetical protein, Possible conserved membrane protein and highly similar to the Z70722|MLCB1770_7 Mycobacterium leprae cosmid B1770 (303 aa), FASTA scores: opt: 812, E(): 1.6e-25, (54.2% identity in 319 aa overlap). Non essential for optimal growth.(http://www.biohealthbase.org/brc/details.do?locus=Rv0007&decorator=mycobacterium) | + | Hypothetical protein, No PDB structure available, Possible conserved membrane protein and highly similar to the Z70722|MLCB1770_7 Mycobacterium leprae cosmid B1770 (303 aa), FASTA scores: opt: 812, E(): 1.6e-25, (54.2% identity in 319 aa overlap). Non essential for optimal growth.(http://www.biohealthbase.org/brc/details.do?locus=Rv0007&decorator=mycobacterium) |
==Protein Sequence== | ==Protein Sequence== | ||
Current revision
| Imunoatation of Rv0007
| |
| Name | |
| POSSIBLE CONSERVED MEMBRANE PROTEIN | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C12H10BrNOS2 [1] |
| Mol. wt. | 31073 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.17 |
Contents |
[edit] General
Hypothetical protein, No PDB structure available, Possible conserved membrane protein and highly similar to the Z70722|MLCB1770_7 Mycobacterium leprae cosmid B1770 (303 aa), FASTA scores: opt: 812, E(): 1.6e-25, (54.2% identity in 319 aa overlap). Non essential for optimal growth.(http://www.biohealthbase.org/brc/details.do?locus=Rv0007&decorator=mycobacterium)
[edit] Protein Sequence
>Rv0007, TB.seq 9914:10825 MW:31042 VTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADA RLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAG SSGGRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNV GDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTLADRD
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| |sp|Q9Y4K1.3 | 26 | 32 | 176 | 0.061 |
| sp|O75962.2 | 27 | 33 | 151 | 0.067 |
| sp|Q13029.3 | 29 | 39 | 89 | 0.13 |
| sp|Q9Y6V0.3 | 25 | 35 | 120 | 0.28 |
| sp|Q6IQ32.1 | 27 | 40 | 86 | 0.46 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]<
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]<
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
