From DrugPedia: A Wikipedia for Drug discovery

Rv2157c
Name
UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D -alanyl ligase MurF
Identifiers
Swiss Prot	P0A5L4
Genbank	887826
PDB	?
Chemical data
Formula	C16H11N5O2 [1]
Mol. wt.	51634 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.6424

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

INVOLVED IN CELL WALL FORMATION; PEPTIDOGLYCAN BIOSYNTHESIS , ProbableUDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl ligase MurF

Rv2157c, (MTCY270.11), len: 510 aa. Probable murF, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl ligase (UDP-MURNAC-PENTAPEPTIDE SYNTHETASE) (see citation below), also related to other Mycobacterium tuberculosis mur gene products. FASTA best: MURF_ECOLI|P11880 (452 aa), opt: 515, E(): 2.6e-24, (31.9% identity in 511 aa overlap).

Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2157c, TB.seq 2417473:2419002 MW:51634 MIELTVAQIAEIVGGAVADISPQDAAHRRVTGTVEFDSRAIGPGGLFLALPGARADGHDHAASAVAAGAAVVLAARPVGV PAIVVPPVAAPNVLAGVLEHDNDGSGAAVLAALAKLATAVAAQLVAGGLTIIGITGSSGKTSTKDLMAAVLAPLGEVVAP PGSFNNELGHPWTVLRATRRTDYLILEMAARHHGNIAALAEIAPPSIGVVLNVGTAHLGEFGSREVIAQTKAELPQAVPH SGAVVLNADDPAVAAMAKLTAARVVRVSRDNTGDVWAGPVSLDELARPRFTLHAHDAQAEVRLGVCGDHQVTNALCAAAV ALECGASVEQVAAALTAAPPVSRHRMQVTTRGDGVTVIDDAYNANPDSMRAGLQALAWIAHQPEATRRSWAVLGEMAELG EDAIAEHDRIGRLAVRLDVSRLVVVGTGRSISAMHHGAVLEGAWGSGEATADHGADRTAVNVADGDAALALLRAELRPGD VVLVKASNAAGLGAVADALVADDTCGSVRP

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9Y2J0.1	3	44	70	2.1
sp|P13611.3	24	46	77	2.8
sp|Q9UNE2.1	34	43	72	6.4

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.