Rv2156c
From DrugPedia: A Wikipedia for Drug discovery
| Rv2156c
| |
| Name | |
| Phospho-N-acetylmuramoyl-pentapeptide-transferase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C14H20BrNO2 [1] |
| Mol. wt. | 37714 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 8.99 |
Contents |
[edit] General
INVOLVED IN CELL WALL FORMATION; PEPTIDOGLYCAN BIOSYNTHESIS. Rv2156c, (MTCY270.12), len: 359 aa. Probable murX, phospho-N-acetylmuramoyl-pentappeptidetransferase (see citation below), similar to others e.g.MRAY_ECOLI|P15876 (360 aa), FASTA scores: opt: 572, E(): 2.7e-29, (35.8% identity in 344 aa overlap); etc. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2156c, TB.seq 2416397:2417473 MW:37714 MRQILIAVAVAVTVSILLTPVLIRLFTKQGFGHQIREDGPPSHHTKRGTPSMGGVAILAGIWAGYLGAHLAGLAFDGEGI GASGLLVLGLATALGGVGFIDDLIKIRRSRNLGLNKTAKTVGQITSAVLFGVLVLQFRNAAGLTPGSADLSYVREIATVT LAPVLFVLFCVVIVSAWSNAVNFTDGLDGLAAGTMAMVTAAYVLITFWQYRNACVTAPGLGCYNVRDPLDLALIAAATAG ACIGFLWWNAAPAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGALFVAEITSVVLQILTFRTTGRRMFRMAPFHHHF ELVGWAETTVIIRFWLLTAITCGLGVALFYGEWLAAVGA
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9H3H5.2 | 23 | 41 | 166 | 0.029 |
| sp|P43320.2 | 33 | 49 | 59 | 0.44 |
| sp|Q9NQX7.1 | 54 | 70 | 24 | 1.7 |
| sp|O94901.3 | 27 | 41 | 84 | 8 |
| sp|Q92696.2 | 37 | 51 | 43 | 9.3 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
