From DrugPedia: A Wikipedia for Drug discovery

Rv2150c
Name
cell division protein (FtsZ)
Identifiers
Swiss Prot	P64170
Genbank	888369
PDB	2Q1Y
Chemical data
Formula	C18H12ClNO4 [1]
Mol. wt.	38757 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.30

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Essential for cell division. It is thought that the intracellular concentration of FtsZ protein is critical for productive septum formation in mycobacteria.

Other PDB: 1RLU 1RQ2 1RQ7 2Q1X

Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2150c, TB.seq 2408386:2409522 MW:38757 MTPPHNYLAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTRGLGAGADPEVGRKAAE DAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIV IPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINVDFADVKGIMSGAGTALMGIGSARGEGRSLKAAEI AINSPLLEASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSLGDEVRVTVIAAGFDVSGPGRK PVMGETGGAHRIESAKAGKLTSTLFEPVDAVSVPLHTNGATLSIGGDDDDVDVPPFMRR

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9NR82.3	35	50	56	1.9
sp|O95834.1	26	43	141	2.4
sp|Q6P2S7.3	27	59	54	2.9
sp|P48643.1	28	44	89	3.1
sp|Q96RV3.2	25	41	98	4.8

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.