Rv2110c

From DrugPedia: A Wikipedia for Drug discovery

Jump to: navigation, search
Rv2110c
Name
proteasome (beta subunit) PrcB
Identifiers
Swiss Prot O33245
Genbank 887508
PDB 2JAY
Chemical data
Formula C12H6BrN3O4 [1]
Mol. wt. 30274 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 4.41

Contents

[edit] General

Helps in Protein degradation. Rv2110c, (MTCY261.06c), len: 291 aa. prcB, proteasome beta-type subunit 2, highly similar to eg. TR:Q53083 (EMBL:U264 22) proteasome beta-type subunit 2 from Rhodococcus (292 aa), FASTA scores; opt: 1103, E(): 0, 64.5% identity in 262 aa overlap. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). prcBA genes encode a proteasome with broad substrate specificity (See Lin et al., 2006).


Other PDBID: 3H6I, 3HFA, 3H6F, 3HF9, 2FHH, 2FHG


essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Proteasome encoded by prcBA genes is essential for persistence and optimal growth in mice; Silencing of prcBA results in increased susceptibility to reactive nitrogen intermediates stress and increased resistance to oxidative stress (See Gandotra et al., 2007). mutants available at TARGET website

[edit] Protein Sequence

>Rv2110c, TB.seq 2369727:2370599 MW:30274 VTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQG NMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPL LAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGG PDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P28074.3 27 42 250 1e-10
sp|P28072.4 27 45 192 5e-07
sp|P28065.2 26 46 202 3e-06
sp|P28062.2 24 41 234 5e-06
sp|P49720.2 25 40 186 0.021



[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.