Rv2041c
From DrugPedia: A Wikipedia for Drug discovery
| Rv2041c
| |
| Name | |
| sugar-binding lipoprotein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C16H13ClN4OS [1] |
| Mol. wt. | 47877 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.52 |
Contents |
[edit] General
Thought to be involved in active transport of sugar across the membrane (import).
Rv2041c, (MTV018.28c), len: 439 aa. Probable sugar-binding lipoprotein component of sugar transport system, equivalent to Z98604|MLCB2052_1|MLCB2052.27 from Mycobacterium leprae (445 aa), FASTA scores: opt: 2324, E(): 0, (77.4% identity in 446 aa overlap). Contains signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2041c, TB.seq 2286528:2287844 MW:47877 MVNKPFERRSLLRGAGALTAASLAPWAAGCAADDDDALTFFFAANPDELRPRMRVVNEFQRRYPDIKVRALLSGPGVMQQ LATFCAGGKCPDVLMAWELTYAELADRGVLLDLNTLLARDQAFAAELKSDSIGALYETFTFNGGQYAFPEQWSGNFLFYN KQLFDDAGVPPPPGSWERPWSFAEFLDAAQALTKQGRSGRDRQWGFVNAWVSFYAAGLFAMNNGVPWSVPRMNPTHLNFD HDGFLEAVQFYADLTNKHKVAPSAAEQQSMSTADLFSVGKAGIALAGHWRYQTFDRADGLDFDVAPLPIGPRGRAACSDI GVTGLAIAATSRRKDQAWEFVKFATGPVGQALIGESRLFVPVLRSAINSHGFANAHRRVGNLAVLSEGPAYSEGLPVTPA WEKIAALMDRYFGPVLRGSRPATSLTGLSQAVDEVLRNP
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P18283.3 | 45 | 51 | 35 | 0.92 |
| sp|Q9UKR3.1 | 37 | 50 | 40 | 1.9 |
| sp|Q149M9.2 | 34 | 48 | 66 | 5.6 |
| sp|P35475.2 | 31 | 50 | 44 | 6.2 |
| sp|Q99996.3 | 28 | 38 | 59 | 9.5 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
