Rv1715
From DrugPedia: A Wikipedia for Drug discovery
| Rv1715
| |
| Name | |
| 3-hydroxybutyryl-CoA dehydrogenase (fadB3) | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C17H15NO3 [1] |
| Mol. wt. | 31507 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.8056 |
Contents |
[edit] General
THOUGHT TO BE INVOLVED IN FATTY ACID DEGRADATION. FADB AND FADA ARE THE ALPHA AND BETA SUBUNITS OF THE MULTIFUNCTIONAL ENZYME COMPLEX OF THE FATTY ACID DEGRADATION CYCLE [CATALYTIC ACTIVITY: (S)-3-hydroxybutanoyl-CoA + NADP+ = 3-acetoacetyl-CoA + NADPH]. essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv1715, TB.seq 1942657:1943568 MW:31507 MLTSHGFSRAAVVGAGLMGRRIAGVLASAGLDVAITDTNAEILHAAAVEAARVAGAGRGSVAAAADLAAAIPDADLVIEA VVENLAVKQELFERLATLAPDAVLATNTSVLPIGAVTERVEDGSRVIGTHFWNPPDLIPVVEVVPSARTAPDTADRVVAL LTQVGKLPVRVGRDVPGFIGNRLQHALWREAIALVAEGVCDPKTVDLVVRNTIGLRLATLGPLENADYIGLDLTLAIHDA VIPSLNHDPHPSPLLRELVAAGQLGARTGHGFLDWPAGAREATTARLAQHIAAQLQANEKGRGT
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q16836.2 | 34 | 48 | 286 | 1e-35 |
| sp|Q9Y2S2.3 | 33 | 56 | 230 | 2e-31 |
| sp|Q08426.3 | 29 | 48 | 291 | 6e-26 |
| sp|P40939.2 | 30 | 49 | 290 | 5e-23 |
| sp|O14531.2 | 31 | 43 | 90 | 0.52 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
