Immunotation of Rv0261c
From DrugPedia: A Wikipedia for Drug discovery
| Immunotation of Rv0261c
| |
| Name | |
| PROBABLE INTEGRAL MEMBRANE NITRITE EXTRUSION PROTEIN NARK3 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 49356.4 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.2036 |
Contents |
[edit] General
INVOLVED IN EXCRETION OF NITRITE PRODUCED BY THE DISSIMILATORY REDUCTION OF NITRATE. RESPONSIBLE FOR THE TRANSLOCATION OF THE SUBSTRATE ACROSS THE MEMBRANE.PROBABLE INTEGRAL MEMBRANE NITRITE EXTRUSION PROTEIN NARK3 (NITRITE FACILITATOR).Rv0261c, (MTCY06A4.05c), len: 469 aa. Probable nirK3, nitrite extrusion protein, integral membrane protein possibly member of major facilitator superfamily (MFS), equivalent to AAB41700.1|U72744 nitrite extrusion protein from Mycobacterium fortuitum (471 aa); and 2342627|CAB11406.1|Z98741|T44908 nitrite extrusion protein homolog from Mycobacterium leprae (517 aa; longer in N-terminus). Also similar to other nitrite extrusion proteins e.g. NARK_ECOLI|P10903|B1223 nitrite extrusion protein 1 from Escherichia coli strain K12 (463 aa), FASTA scores: opt: 755, E(): 0, (35.0% identity in 466 aa overlap). BELONGS TO THE NARK/NASA FAMILY OF TRANSPORTERS.
[edit] Protein Sequence
>Rv0261c, TB.seq 312760:314166 MW:49358
MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWSLWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACL
RFPYTFATAKFGGRNWTIFSALVLLIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALA
LNAGGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELNTMRAVVSEPHTWVISLLY
IGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAFLGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGI
LISASTFGDHLAGPMPTATMVGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAGA
VGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVPATTAPAGLAYV
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue | |
| sp|Q9BYT1.2| | 27 | 41 | 173 | 0.75 | |
| sp|A6NK97.1| | 27 | 48 | 98 | 1.4 | |
| sp|P98160.3| | 34 | 43 | 66 | 2.9 | |
| sp|Q92544.2| | 27 | 42 | 69 | 7.3 | |
| sp|Q9UFH2.2| | 28 | 44 | 45 | 8.3 |
[edit] Alergen Protein
Link to Algpred
Non Allergen
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Intergral Membrane Protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by[1]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by[2]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by[3]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [4]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by[5]
[edit] MHC Class-II Binder
[edit] Propred Analysis
[edit] NetMHC-II Analysis
Link to NetMHC-II
Results[
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
