From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv3921c
Name
<Rv3921c> conserved membrane protein
Identifiers
Swiss Prot	P65626
Genbank	?
PDB	structure available No structure available
Chemical data
Formula	?
Mol. wt.	40884.2
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	10.6257

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap.The primary data source for this dataset was the full genome sequence of Mycobacterium tuberculosis strain H37Rv, derived from Genbank entry AL123456. This dataset was derived computationally using the PathoLogic program.

[edit] Protein Sequence

>Rv3921c, TB.seq 4408969:4410066 MW:40885 VSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQ KKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVG HFLDANLFGAPIGAYMTQRSGLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPGAKPKRSPKTAPATNAAAPTE AGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVRPKKRKR

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q70CQ4	31	53	63	0.43
sp|Q7RTS5	32	40	64	0.72
sp|P08240	33	50	57	0.81
sp|Q14202	26	43	87	0.84
sp|Q8N954	26	47	82	0.92

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
INTEGRAL MEMBRANE PROTEIN

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.