Immunotation of Rv1613
From DrugPedia: A Wikipedia for Drug discovery
| Immunotation of Rv1613
| |
| Name | |
| <Rv1613>Tryptophan synthase alpha chain | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 27728 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.6768 |
Contents |
[edit] General
EcoRI endonuclease digestion of the deoxyribonucleic acid of a phi80 transducing phage carrying the entire tryptophan (trp) operon of Salmonella typhimurium (phi80 S.t.trpE-A) yielded a 4.3 X 10(6)-dalton fragment containing intact trpE, trpD, and trpC and a 3.35 X 10(6)-dalton fragment containing intact trpA. The trpA fragment inserted into EcoRI-cleaved plasmids ColE1 and CR1 was expressed regardless of its orientation of insertion. Mitomycin C, a compound that induces colicin E1 production in ColE1-containing bacteria, stimulated tryptophan synthetase alpha production in cells containing ColE1-TRPA plasmids with the trpA fragment inserted in one orientation but not the other. We conclude that in the inducible plasmids trpA can be expressed from the colicin E1 promoter.
[edit] Protein Sequence
>Rv1613, TB.seq 1812357:1813166 MW:27728 MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYSDPGMDGPTIARATEAAL RGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLV APSSTPERLAATVEASRGFVYAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS ALVTALTEGLPRLRALTGELAAGVRLGMSA
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9Y4E6 | 29 | 40 | 125 | 0.008 |
| sp|Q8IX03 | 32 | 42 | 87 | 2.4 |
| sp|Q8NEL9 | 31 | 42 | 87 | 2.5 |
| sp|P11532 | 26 | 42 | 109 | 4.4 |
| sp|Q8IYB8 | 30 | 61 | 26 | 4.9 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
INTEGRAL MEMBRANE PROTEIN
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
