From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv0260c
Name
PPOSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN
Identifiers
Swiss Prot	P95217
Genbank	[http://www.ncbi.nlm.nih.gov/sites/entrez?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=923195 923195[1]]
PDB	?
Chemical data
Formula	?
Mol. wt.	40732.6 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	7.1122

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) Rv0260c, (MTCY0A4.04c), len: 381 aa. Possible two-component response regulator, highly similar to CAB72204.1|AL138851 putative transcriptional regulator from Streptomyces coelicolor (395 aa); and similar to O34394|D69851|YJJA conserved hypothetical protein from Bacillus subtilis (270 aa), FASTA scores: opt: 312, E(): 7.4e-14, (25.8% identity in 267 aa overlap). Also some similarity to regulatory proteins at C-terminal region e.g. CUTR_STRLI|Q03756 transcriptional regulatory protein (217 aa), FASTA scores: opt: 138, E(): 0.02, (30.6% identity in 111 aa overlap).

[edit] Protein Sequence

>Rv0260c, TB.seq 311515:312657 MW:40734

MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEALIADPPDILVAHTGIGFRGWL AAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFP EFLGGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVH RPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9Y4B6.3	23	37	105	7.4

[edit] Alergen Protein

Link to Algpred
Non Allergen

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic Protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred  
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by[3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result predicted by [5]

[edit] IEDB Analysis

Link to IEDB
Results[6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Results[7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Results[8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.