Rv2138

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 18:54, 13 April 2010 by Nitinkumar (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search
Rv2138
Name
lipoprotein (LppL)
Identifiers
Swiss Prot O06237
Genbank 887303
PDB  ?
Chemical data
Formula C15H10BrNO4 [1]
Mol. wt. 36819 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 7.7892

Contents

[edit] General

Function Unknown. Rv2138, (MTCY270.30c), len: 358 aa. Probable lppL, conserved lipoprotein, with appropriately placed lipoprotein signature (PS00013) strongly similar to hypothetical Mycobacterium leprae protein, Q49806. FASTA best: Q49806 B2126_F3_142. (298 aa) opt: 1495, E(): 0; (75.3% identity in 300 aa overlap). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website.

[edit] Protein Sequence

>Rv2138, TB.seq 2397328:2398401 MW:36819 LLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQL VALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIA RRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAG QGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRY PTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR


[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q6XZF7.1 40 54 37 0.47
sp|Q05BV3.3 22 39 2040.58
sp|Q9UHB4.1 43 51 41 0.77
sp|P42858.1 26 45 45 1.5
sp|Q2Q1W2.1 22 40 149 2.3



[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.