From DrugPedia: A Wikipedia for Drug discovery

Rv1714
Name
oxidoreductase
Identifiers
Swiss Prot	O53927
Genbank	885159
PDB	?
Chemical data
Formula	C16H14ClN3OS [1]
Mol. wt.	27955 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.7751

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

FUNCTION UNKNOWN; PROBABLY INVOLVED IN CELLULAR METABOLISM. Rv1714, (MTV048.01), len: 270 aa. Probable oxidoreductase similar to many e.g. AE0010|AE001021_4 Archaeoglobus fulgidus section 79 (281 aa), FASTA scores: opt: 578, E(): 3.3e-31, (38.9% identity in 265 aa overlap). Also similar to several other M. tuberculosis oxidoreductases e.g. Rv1544, etc. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv1714, TB.seq 1941851:1942660 MW:27955 VEEMALAQQVPNLGLARFSVQDKSILITGATGSLGRVAARALADAGARLTLAGGNSAGLAELVNGAGIDDAAVVTCRPDS LADAQQMVEAALGRYGRLDGVLVASGSNHVAPITEMAVEDFDAVMDANVRGAWLVCRAAGRVLLEQGQGGSVVLVSSVRG GLGNAAGYSAYCPSKAGTDLLAKTLAAEWGGHGIRVNALAPTVFRSAVTEWMFTDDPKGRATREAMLARIPLRRFAEPED FVGALIYLLSDASSFYTGQVMYLDGGYTAC

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q7Z4W1.2	34	51	249	3e-29
sp|Q9BTZ2.2	30	51	257	2e-22
sp|Q8N4T8.3	31	47	245	4e-22
sp|Q9BY49.2	24	47	257	3e-19
sp|Q92506.2	28	48	251	1e-17

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.