From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv3340
Name
O-acetylhomoserineaminocarboxypropyltransferase
Identifiers
Swiss Prot	O53390
Genbank	888037
PDB	?
Chemical data
Formula	[]
Mol. wt.	47370.6 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.19

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

In enzymology, an O-acetylhomoserine aminocarboxypropyltransferase is an enzyme that catalyzes the chemical reaction

   O-acetyl-L-homoserine + methanethiol ---   L-methionine + acetate

Thus, the two substrates of this enzyme are O-acetyl-L-homoserine and methanethiol, whereas its two products are L-methionine and acetate.

This enzyme belongs to the family of transferases, specifically those transferring aryl or alkyl groups other than methyl groups. The systematic name of this enzyme class is O-acetyl-L-homoserine:methanethiol 3-amino-3-carboxypropyltransferase. Other names in common use include O-acetyl-L-homoserine acetate-lyase (adding methanethiol), O-acetyl-L-homoserine sulfhydrolase, O-acetylhomoserine (thiol)-lyase, O-acetylhomoserine sulfhydrolase, and methionine synthase. This enzyme participates in methionine metabolism and cysteine metabolism.

Protein Sequence

>Rv3340, TB.seq 3726123:3727469 MW:47372 MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQ RIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNT KAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFD WTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAA RDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|P32929	34	52	403	8e-55
sp|Q9UJX2	23	42	94	1.2
sp|Q5VU43	35	50	62	2.8
sp|Q9NYC9	30	47	71	4.2

Alergen Protein

Link to Algpred
Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Integral Membrane Protein

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by [1]

ABCpred Analysis

Link to ABCpred
Result Predicited by [2]

IEDB Analysis

Link to IEDB
Result Predicited by [3]

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by []

IEDB Analysis

Link to IEDB
Result Predicted by []

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by []

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by []

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.