Immunotatin of Rv3151

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 05:52, 1 February 2010 by Amitfmox4rd (Talk | contribs)
Jump to: navigation, search
Immunotatin of Rv3151
Name
NADH dehydrogenase subunit G
Identifiers
Swiss Prot P95175
Genbank 887540
PDB  ?
Chemical data
Formula  ?
Mol. wt. 85423.2
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.28

Contents

General

Inhibiion of apoptosis is an important event brought about by Mycobacterium Tuberculosis proteins to conquer the surrounding cells.The survival and persistence of Mycobacterium tuberculosis depends on its ability to actively inhibit the death by apoptosis of infected host cells. The genetic basis for this anti-apoptotic activity and its implication for mycobacterial virulence have not been demonstrated or elucidated. Using a novel gain-of-function genetic screen, we demonstrated that inhibition of infection-induced apoptosis of macrophages is controlled by multiple genetic loci in M. tuberculosis. Characterization of one of these loci in detail revealed that the anti-apoptosis activity was attributable to the type I NADH-dehydrogenase of M. tuberculosis, and was mainly due to the subunit of this multicomponent complex encoded by the nuoG gene. Expression of M. tuberculosis nuoG in nonpathogenic mycobacteria endowed them with the ability to inhibit apoptosis of infected human or mouse macrophages, and increased their virulence in a SCID mouse model. Conversely, deletion of nuoG in M. tuberculosis ablated its ability to inhibit macrophage apoptosis and significantly reduced its virulence in mice. These results identify a key component of the genetic basis for an important virulence trait of M. tuberculosis and support a direct causal relationship between virulence of pathogenic mycobacteria and their ability to inhibit macrophage apoptosis.

Protein Sequence

>Rv3151, TB.seq 3516743:3519160 MW:85393 VTQAADTDIRVGQPEMVTLTIDGVEISVPKGTLVIRAAELMGIQIPRFCDHPLLEPVGACRQCLVEVEGQRKPLASCTTV ATDDMVVRTQLTSEIADKAQHGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEAKRTFAKPINISAQVLLD RERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADEPFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVC EHCASGCAQRTDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLIRDGGDPKGALVPTSWSHAMAVAAQ GLAAARGRTGVLVGGRVTWEDAYAYAKFARITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF EPEDESPIVFLRLRKAARRHRVPVYTIAPFATGGLHKMSGRLIKTVPGGEPAALDDLATGAVGDLLATPGAVIIVGERLA TVPGGLSAAARLADTTGARLAWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHIAELPAAAGRDADGILAA AADETLAALLVGGIEPADFADPDAVLAALDATGFVVSLELRHSTVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALR GSTLQAGQSDHRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQPEAGEAILTGWRMLLDEGRL QDGEPYLAGTARTPVVRLSPDTAAEIGAADGEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV KIGAGS

Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P28331 31 46 683 1e-67
sp|Q96RG2 27 40 140 1.7
sp|Q9UFP1 28 43 78 4.2
sp|Q9UPY6 38 52 36 4.9
p|Q2M3C7 51 72 29 6.2

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cyoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by []

ABCpred Analysis

Link to ABCpred
Result Predicited by []

IEDB Analysis

Link to IEDB
Result Predicited by []

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by []

IEDB Analysis

Link to IEDB
Result Predicted by []

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by []


NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by []

External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.