From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv0015c
Name
<Rv0015> transmembrane serine/threonine-protein kinase A pknA
Identifiers
Swiss Prot	P65726
Genbank	885953
PDB	?
Chemical data
Formula	[]
Mol. wt.	45596.9
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	11.1868

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis

General

The Mycobacterium tuberculosis genome contains 11 serine/threonine kinase genes including two, pknA and pknB, that are part of an operon encoding genes involved in cell shape control and cell wall synthesis. Here we demonstrate that pknA and pknB are predominantly expressed during exponential growth, and that overexpression of these kinases slows growth and alters cell morphology. We determined the preferred substrate motifs of PknA and PknB, and identified three in vivo substrates of these kinases: PknB; Wag31, an ortholog of the cell division protein DivIVA

Protein Sequence

>Rv0015c, TB.seq 17470:18762 MW:45598 MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYG ESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDF GIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSR PATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE RGETRHSGLQSWVVPPTPHSRASLARYEIAQ

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9UBS0	31	50	259	2e-26
sp|Q8TD08	32	48	238	1e-25
sp|Q8TDC3	28	45	286	1e-25
sp|P22612	31	47	250	1e-25
sp|Q9P0L2	33	48	225	2e-25

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
integral membrane protein

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

IEDB Analysis

Link to IEDB
Result Predicited by IEDB

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

IEDB Analysis

Link to IEDB
Result Predicted by [2]

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by [3]

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]