Immunotation of rv1980c
From DrugPedia: A Wikipedia for Drug discovery
Immunotation of rv1980c
| |
Name | |
Immunogenic protein MPT64 | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | |
Chemical data | |
Formula | [1] |
Mol. wt. | 24,824Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.5994 |
Contents |
General
Gene name for the entry Rv1980c is mpt64 and its gene product is immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation .
Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64.
NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg.
Protein Sequence
>Rv1980c, TB.seq 2223344:2224027 MW:24824 VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSA ATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFP IVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q13464 | 23 | 42 | 148 | 0.14 |
sp|P98155 | 29 | 42 | 100 | 0.50 |
sp|Q8N6C5 | 24 | 37 | 90 | 2.3 |
sp|Q8NG31 | 25 | 45 | 55 | 2.7 |
sp|Q8WW52 | 34 | 48 | 72 | 3.1 |
Alergen Protein
Link to Algpred
Allergen as Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Protein attatched to membrane by lipid anchor
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
IEDB Analysis
Link to IEDB
Result Predicited by []
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [4]
IEDB Analysis
Link to IEDB
Result Predicted by [5]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [6]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [7]
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.