Immunotation of Rv2754c
From DrugPedia: A Wikipedia for Drug discovery
Immunotation of Rv2754c
| |
Name | |
Thymidylate synthase thyX | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | |
Chemical data | |
Formula | [1] |
Mol. wt. | 32152.9 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 7.02 |
Contents |
General
flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor
POSSIBLE MOLECULAR FUNTION
1.FAD Binding Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
2.Thymidylate Synthase (FAD) Activity Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP + FADH2 = dTMP + tetrahydrofolate + FAD.
Protein Sequence
>Rv2754c, TB.seq 3067193:3067942 MW:27560 VAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGYLRHIIDVGHFSVLEHASVSF YITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNA ILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE VATSPLATEA
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|O15245| | 29 | 42 | 54 | 0.52 |
sp|Q5SXH7| | 29 | 40 | 67 | 1.4 |
sp|O15068| | 28 | 41 | 67 | 2.4 |
sp|P35520| | 25 | 55 | 47 | 2.6 |
sp|Q9UI47| | 32 | 52 | 61 | 9.5 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cytoplasmic protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicted By
IEDB Analysis
Link to IEDB
MHC Class-II Binder
Propred Analysis
Link to Propred
IEDB Analysis
Link to IEDB
MHC Class-II Binder
Propred Analysis
Link to Propred
NetMHC-II Analysis
Link to NetMHC-II
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.