Immunotation of Rv0260c
From DrugPedia: A Wikipedia for Drug discovery
Immunotation of Rv0260c
| |
Name | |
PPOSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | ? |
Mol. wt. | 40732.6 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 7.1122 |
Contents |
General
non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) Rv0260c, (MTCY0A4.04c), len: 381 aa. Possible two-component response regulator, highly similar to CAB72204.1|AL138851 putative transcriptional regulator from Streptomyces coelicolor (395 aa); and similar to O34394|D69851|YJJA conserved hypothetical protein from Bacillus subtilis (270 aa), FASTA scores: opt: 312, E(): 7.4e-14, (25.8% identity in 267 aa overlap). Also some similarity to regulatory proteins at C-terminal region e.g. CUTR_STRLI|Q03756 transcriptional regulatory protein (217 aa), FASTA scores: opt: 138, E(): 0.02, (30.6% identity in 111 aa overlap).
Protein Sequence
>Rv0260c, TB.seq 311515:312657 MW:40734
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEALIADPPDILVAHTGIGFRGWL AAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFP EFLGGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVH RPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9Y4B6.3 | 23 | 37 | 105 | 7.4 |
Alergen Protein
Link to Algpred
Non Allergen
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cytoplasmic Protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
ABCpred Analysis
Link to ABCpred
Result Predicited by[3]
IEDB Analysis
Link to IEDB
Result Predicited by [4]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result predicted by []