From DrugPedia: A Wikipedia for Drug discovery

Rv2110c
Name
proteasome (beta subunit) PrcB
Identifiers
Swiss Prot	O33245
Genbank	887508
PDB	2JAY
Chemical data
Formula	C12H6BrN3O4 [1]
Mol. wt.	30274 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.41

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

Helps in Protein degradation. Rv2110c, (MTCY261.06c), len: 291 aa. prcB, proteasome beta-type subunit 2, highly similar to eg. TR:Q53083 (EMBL:U264 22) proteasome beta-type subunit 2 from Rhodococcus (292 aa), FASTA scores; opt: 1103, E(): 0, 64.5% identity in 262 aa overlap. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). prcBA genes encode a proteasome with broad substrate specificity (See Lin et al., 2006).

Other PDBID: 3H6I 3HFA 3H6F 3HF9 2FHH 2FHG

essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Proteasome encoded by prcBA genes is essential for persistence and optimal growth in mice; Silencing of prcBA results in increased susceptibility to reactive nitrogen intermediates stress and increased resistance to oxidative stress (See Gandotra et al., 2007). mutants available at TARGET website

Protein Sequence

>Rv2110c, TB.seq 2369727:2370599 MW:30274 VTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQG NMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPL LAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGG PDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|P28074.3	27	42	250	1e-10
sp|P28072.4	27	45	192	5e-07
sp|P28065.2	26	46	202	3e-06
sp|P28062.2	24	41	234	5e-06
sp|P49720.2	25	40	186	0.021

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cytoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

IEDB Analysis

Link to IEDB
Result Predicited by [4]

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

IEDB Analysis

Link to IEDB
Result Predicted by [6]

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by [7]

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.