From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv0444c
Name
Anti-sigma-K factor rskA
Identifiers
Swiss Prot	O53729
Genbank	886346
PDB	?
Chemical data
Formula	C28H37ClN4O6 [1]
Mol. wt.	23883 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	?

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

The gene rv0444c in mycobacterium tuberculosis genome codes for protein named Anti-sigma-K factor rskA.The function of this protein is to represses sigK, the extracytoplasmic function (ECF) sigma factor K, by binding to it and inhibiting its activity. This leads to a decreased expression of sigK-regulated genes, such as mpt70 and mpt83.It has recently been advanced that Mycobacterium tuberculosis sigma factor K (SigK) positively regulates expression of the antigenic proteins MPB70 and MPB83.Analysis of in vitro mpt70/mpt83 expression and Rv0444c sequencing across M. tuberculosis complex (MTC) members revealed that high-level expression was associated with a mutated Rv0444c.

Protein Sequence

>Rv0444c, TB.seq 533092:533787 MW:23884 MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKP EVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNV APPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cyoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by []

ABCpred Analysis

Link to ABCpred
Result Predicited by []

IEDB Analysis

Link to IEDB
Result Predicited by [B]

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by []

IEDB Analysis

Link to IEDB
Result Predicted by []

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by []

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by []

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.