Immunoatation of Rv2711

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 09:23, 26 January 2010 by Amitfmox4rd (Talk | contribs)
Jump to: navigation, search
Immunoatation of Rv2711
Name
IRON-dependent repressor and activator IDER
Identifiers
Swiss Prot P0A672
Genbank 888590
PDB 1FX7
Chemical data
Formula  ?
Mol. wt. 25232.7
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.05

Contents

General

The mycobacterial IdeR protein is a metal-dependent regulator of the DtxR (diphtheria toxin repressor) family. In the presence of iron, it binds to a specific DNA sequence in the promoter regions of the genes that it regulates, thus controlling their transcription.A study has provided the evidence of ideR as an essential gene in Mycobacterium tuberculosis. ideR cannot normally be disrupted in this mycobacterium in the absence of a second functional copy of the gene. However, a rare ideR mutant was obtained in which the lethal effects of ideR inactivation were alleviated by a second-site suppressor mutation and which exhibited restricted iron assimilation capacity. Studies of this strain and a derivative in which IdeR expression was restored allowed to identify phenotypic effects resulting from ideR inactivation. Using DNA microarrays, the iron-dependent transcriptional profiles of the wild-type, ideR mutant, and ideR-complemented mutant strains were analyzed, and the genes regulated by iron and IdeR were identified. These genes encode a variety of proteins, including putative transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, a membrane protein involved in virulence, transcriptional regulators, and enzymes involved in lipid metabolism.

Protein Sequence

>Rv2711, TB.seq 3023562:3024251 MW:25234 MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAG SPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV

Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P07358 30 53 39 0.87
sp|Q8TEQ8 40 54 35 2.4
sp|Q9P273 32 50 46 5.2
sp|Q9NZQ8 33 50 54 7.5
sp|P25092 27 46 80 9.2

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cyoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by [1]

ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred