From DrugPedia: A Wikipedia for Drug discovery

Immunotation of Rv3596c
Name
<Rv3596c> ATP-dependent protease ATP-binding subunit ClpC1
Identifiers
Swiss Prot	P0A522
Genbank	?
PDB	none
Chemical data
Formula	?
Mol. wt.	93554 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	?

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

Rv3596c, (MTCY07H7B.26), clpC, len: 848. Probable atp-dependent clp protease atp-binding subunit, highly similar to members of the clpA/clpB family, e.g. MECB_BACSU P37571 negative regulator of genetic competence mecB (810 aa),fasta scores, opt: 2969, E(): 0, (61.2% identity in 811 aaoverlap); contains PS00017 ATP/GTP-binding site motif A. Updated info: Functional Category: intermediary metabolism and respiration. EC:3.4.-.-The ATP-dependent protease Clp plays important roles in the cell's protein quality control system and in the regulation of cellular processes. In Corynebacterium glutamicum, the levels of the proteolytic subunits ClpP1 and ClpP2 as well as of the corresponding mRNAs were drastically increased upon deletion of the clpC gene, coding for a Clp ATPase subunit. We identified a regulatory protein, designated ClgR, binding to a common palindromic sequence motif in front of clpP1P2 as well as of clpC. Deletion of clgR in the DeltaclpC background completely abolished the increased transcription of both operons,

Protein Sequence

>Rv3596c, TB.seq 4038158:4040701 MW:93554 MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGG ESGSPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTI GATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAI DLIDEAGARMRIRRMTAPPDLREFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWRSGDLDVVAEVD DEQIAEVLGNWTGIPVFKLTEAETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKT ELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQ VLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKPVGLGFSKGGGENDYERMKQKVNDELKKHFRPEFLNRIDDIIVFH QLTREEIIRMVDLMISRVAGQLKSKDMALVLTDAAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQVV TVDVDNWDGEGPGEDAVFTFTGTRKPPAEPDLAKAGAHSAGGPEPAAR

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

IEDB Analysis

Link to IEDB
Result Predicited by IEDB

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

IEDB Analysis

Link to IEDB
Result Predicted by [2]

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by [3]

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by []

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.