Rv2122c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> Phosphoribosyl-ATP pyrophosphatase (hisE) </b> |image= | width=250 |image2= |Swiss Prot = P0A5B1 | Genbank = 888671 | PDB = 1Y6X ...) |
|||
| Line 68: | Line 68: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv2122.pdf] |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv21221.pdf] |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv21222.pdf] |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
| Line 81: | Line 81: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv21223.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv21224.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv21225.pdf] |
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv21226.txt] |
=External Links= | =External Links= | ||
Current revision
| Rv2122c
| |
| Name | |
| Phosphoribosyl-ATP pyrophosphatase (hisE) | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | C19H15FO5 [1] |
| Mol. wt. | 10243 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.3758 |
Contents |
[edit] General
THOUGHT TO BE INVOLVED IN HISTIDINE BIOSYNTHESIS. Other PDBid: 3C90
Rv2122c, (MTCY261.18), len: 93 aa. Probable hisE (alternate gene name: irg1), phosphoribosyl-AMP cyclohydrolase (see citation below), similar to N-terminus of e.g. HIS2_SYNY3 P74755 phosphoribosyl-AMP cyclohydrolase (230 aa), FASTA scores; opt: 150, E(): 4e-08, (37.9% identity in 87 aa overlap); etc. Note that previously misnamed hisI. DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2122c, TB.seq 2380664:2380942 MW:10243 VQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMI SRGLSLDDVYRKL
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8TC76.1 | 42 | 71 | 28 | 0.71 |
| sp|Q8NI51.1 | 26 | 47 | 80 | 2.4 |
| sp|Q6EKJ0.1 | 36 | 56 | 30 | 6.8 |
| sp|Q86UP8.2 | 36 | 56 | 30 | 7.3 |
| sp|Q6ZS81.3 | 20 | 36 | 60 | 7.6 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
