From DrugPedia: A Wikipedia for Drug discovery

Revision as of 15:01, 20 April 2010 (edit) Abhik1368 (Talk | contribs) ← Previous diff		Revision as of 17:39, 21 April 2010 (edit) (undo) Abhik1368 (Talk | contribs) Next diff →
Line 82:		Line 82:
	==Propred Analysis==		==Propred Analysis==
	Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>		Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
		+	result[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_Class0261c.doc]
		+
		+	==NetMHC-II Analysis==
		+	Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
		+	Results[

---

Revision as of 17:39, 21 April 2010

Immunotation of Rv0261c
Name
PROBABLE INTEGRAL MEMBRANE NITRITE EXTRUSION PROTEIN NARK3
Identifiers
Swiss Prot	P95218
Genbank	CAB06688
PDB	structure found no structure found
Chemical data
Formula	?
Mol. wt.	49356.4
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	9.2036

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis

General

INVOLVED IN EXCRETION OF NITRITE PRODUCED BY THE DISSIMILATORY REDUCTION OF NITRATE. RESPONSIBLE FOR THE TRANSLOCATION OF THE SUBSTRATE ACROSS THE MEMBRANE.PROBABLE INTEGRAL MEMBRANE NITRITE EXTRUSION PROTEIN NARK3 (NITRITE FACILITATOR).Rv0261c, (MTCY06A4.05c), len: 469 aa. Probable nirK3, nitrite extrusion protein, integral membrane protein possibly member of major facilitator superfamily (MFS), equivalent to AAB41700.1|U72744 nitrite extrusion protein from Mycobacterium fortuitum (471 aa); and 2342627|CAB11406.1|Z98741|T44908 nitrite extrusion protein homolog from Mycobacterium leprae (517 aa; longer in N-terminus). Also similar to other nitrite extrusion proteins e.g. NARK_ECOLI|P10903|B1223 nitrite extrusion protein 1 from Escherichia coli strain K12 (463 aa), FASTA scores: opt: 755, E(): 0, (35.0% identity in 466 aa overlap). BELONGS TO THE NARK/NASA FAMILY OF TRANSPORTERS.

Protein Sequence

>Rv0261c, TB.seq 312760:314166 MW:49358

MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWSLWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACL RFPYTFATAKFGGRNWTIFSALVLLIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALA LNAGGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELNTMRAVVSEPHTWVISLLY IGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAFLGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGI LISASTFGDHLAGPMPTATMVGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAGA VGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVPATTAPAGLAYV

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9BYT1.2|	27	41	173	0.75
sp|A6NK97.1|	27	48	98	1.4
sp|P98160.3|	34	43	66	2.9
sp|Q92544.2|	27	42	69	7.3
sp|Q9UFH2.2|	28	44	45	8.3

Alergen Protein

Link to Algpred
Non Allergen

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Intergral Membrane Protein

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by[1]

ABCpred Analysis

Link to ABCpred
Result Predicited by[2]

IEDB Analysis

Link to IEDB
Result Predicited by[3]

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [4]

IEDB Analysis

Link to IEDB
Result Predicted by[5]

MHC Class-II Binder

Propred Analysis

Link to Propred
result[6]

NetMHC-II Analysis

Link to NetMHC-II
Results[