Immunotation of Rv3459c
From DrugPedia: A Wikipedia for Drug discovery
| Line 86: | Line 86: | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
Result Predicted by[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_Class-II_prophed3459c.doc]<br> | Result Predicted by[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_Class-II_prophed3459c.doc]<br> | ||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:NetMHCII3459c.doc] | ||
| + | |||
| + | =External Links= | ||
| + | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
| Immunotation of Rv3459c
| |
| Name | |
| PROBABLE 30S RIBOSOMAL PROTEIN S11 RPSK | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 147848.8 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 12.22 |
Contents |
[edit] General
S11 PLAYS AN ESSENTIAL ROLE FOR THE SELECTION OF THE CORRECT TRNA IN PROTEIN BIOSYNTHESIS. IT IS LOCATED ON THE LARGE LOBE OF THE SMALL SUBUNIT Rv3459c, (MTCY13E12.12c), len: 139 aa. Probable rpsK, 30S ribosomal protein S11, equivalent to Q9X7A0|RS11_MYCLE|RPSK|ML1959|MLCB1222.29c 30S RIBOSOMAL PROTEIN S11 from Mycobacterium leprae (138 aa), FASTA scores: opt: 819, E(): 7.6e-44, (89.95% identity in 139 aa overlap); and P45812|RS11_MYCBO 30S RIBOSOMAL PROTEIN S11 from Mycobacterium bovis (139 aa), FASTA scores: opt: 867, E(): 8.4e-47, (94.25% identity in 139 aa overlap). Also highly similar to others e.g. P72403|RS11_STRCO|SC6G4.06 from Streptomyces coelicolor (134 aa), FASTA scores: opt: 729, E(): 2.6e-38, (79.85% identity in 139 aa overlap); O50633|RS11_BACHD|RPSK|BH0161 from Bacillus halodurans (129 aa), FASTA scores: opt: 618, E(): 1.7e-31, (70.3% identity in 128 aa overlap); P04969|RS11_BACSU|RPSK from Bacillus subtilis (131 aa), FASTA scores: opt: 601, E(): 2e-30, (69.0% identity in 129 aa overlap); etc. Contains ribosomal protein S11 signature (PS00054). BELONGS TO THE S11P FAMILY OF RIBOSOMAL PROTEINS.
[edit] Protein Sequence
>Rv3459c, TB.seq 3879272:3879688 MW:14786
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENA ARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P82912.2 | 44 | 61 | 109 | 3e-15 |
| sp|P62263.3 | 34 | 58 | 117 | 2e-13 |
| sp|Q9UH73.2 | 27 | 38 | 73 | 0.24 |
| sp|Q12800.2 | 26 | 42 | 61 | 0.47 |
| sp|Q8WW22.1 | 31 | 37 | 58 | 1.4 |
[edit] Alergen Protein
Link to Algpred
ALLERGEN (By IgE method)
NON ALLERGEN
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
PROTEIN ATTACHED TO MEMBRANE BY LIPID ANCHOR
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by[3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
Result Predicted by [7]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by[8]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [9]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
