Rv2041c

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search

Nitinkumar (Talk | contribs)
(New page: {{immunebox | Name =<b> sugar-binding lipoprotein </b> |image= | width=250 |image2= |Swiss Prot = O53485 | Genbank = 887474 | PDB = | DrugBank ...)
Next diff →

Current revision

Rv2041c
Name
sugar-binding lipoprotein
Identifiers
Swiss Prot O53485
Genbank 887474
PDB  ?
Chemical data
Formula C16H13ClN4OS [1]
Mol. wt. 47877 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 6.52

Contents

[edit] General

Thought to be involved in active transport of sugar across the membrane (import).

Rv2041c, (MTV018.28c), len: 439 aa. Probable sugar-binding lipoprotein component of sugar transport system, equivalent to Z98604|MLCB2052_1|MLCB2052.27 from Mycobacterium leprae (445 aa), FASTA scores: opt: 2324, E(): 0, (77.4% identity in 446 aa overlap). Contains signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site.

Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2041c, TB.seq 2286528:2287844 MW:47877 MVNKPFERRSLLRGAGALTAASLAPWAAGCAADDDDALTFFFAANPDELRPRMRVVNEFQRRYPDIKVRALLSGPGVMQQ LATFCAGGKCPDVLMAWELTYAELADRGVLLDLNTLLARDQAFAAELKSDSIGALYETFTFNGGQYAFPEQWSGNFLFYN KQLFDDAGVPPPPGSWERPWSFAEFLDAAQALTKQGRSGRDRQWGFVNAWVSFYAAGLFAMNNGVPWSVPRMNPTHLNFD HDGFLEAVQFYADLTNKHKVAPSAAEQQSMSTADLFSVGKAGIALAGHWRYQTFDRADGLDFDVAPLPIGPRGRAACSDI GVTGLAIAATSRRKDQAWEFVKFATGPVGQALIGESRLFVPVLRSAINSHGFANAHRRVGNLAVLSEGPAYSEGLPVTPA WEKIAALMDRYFGPVLRGSRPATSLTGLSQAVDEVLRNP


[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P18283.3 45 51 35 0.92
sp|Q9UKR3.1 37 50 40 1.9
sp|Q149M9.2 34 48 66 5.6
sp|P35475.2 31 50 44 6.2
sp|Q99996.3 28 38 59 9.5



[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.