From DrugPedia: A Wikipedia for Drug discovery

---

Revision as of 18:16, 19 February 2010

Rv0208c
Name
tRNA (guanine-N(7)-)-methyltransferase
Identifiers
Swiss Prot	P67498
Genbank	886740
PDB	3D8V 3D98 3DJ4 3FOQ 2QKX 3D8V 3D98 3DJ4 3FOQ
Chemical data
Formula	C16H15Cl2NO2 [1]
Mol. wt.	28548 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	9.8

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

HYPOTHETICAL METHLYTRANSFERASE (METHYLASE) , intermediary metabolism and respiration, Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

Protein Sequence

>Rv0208c, TB.seq 248116:248904 MW:28548 MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRETWERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVV LEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDP WPKARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTELLPISVVRPATKYERKAQL GGGAVIELLWKKHGCSERDLKIR

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9UBP6.1	21	30	160	3e-04
sp|Q9Y5R4.1	45	67	31	0.24
sp|O95936.3	34	53	43	0.82
sp|Q2MV58.2	24	52	57	2.0
sp|Q9Y5S8.2	23	43	91	2.6

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cytoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by

ABCpred Analysis

Link to ABCpred
Result Predicited by

IEDB Analysis

Link to IEDB
Result Predicited by

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by nHLApred

IEDB Analysis

Link to IEDB
Result Predicted by IEDB

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.