Immunotation of Rv0444c
From DrugPedia: A Wikipedia for Drug discovery
(→B cell Epitopes) |
(→IEDB Analysis) |
||
| Line 81: | Line 81: | ||
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ1.pdf] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
Revision as of 08:42, 18 February 2010
| Immunotation of Rv0444c
| |
| Name | |
| Anti-sigma-K factor rskA | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C28H37ClN4O6 [1] |
| Mol. wt. | 23883 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | ? |
Contents |
General
The gene rv0444c in mycobacterium tuberculosis genome codes for protein named Anti-sigma-K factor rskA.The function of this protein is to represses sigK, the extracytoplasmic function (ECF) sigma factor K, by binding to it and inhibiting its activity. This leads to a decreased expression of sigK-regulated genes, such as mpt70 and mpt83.It has recently been advanced that Mycobacterium tuberculosis sigma factor K (SigK) positively regulates expression of the antigenic proteins MPB70 and MPB83.Analysis of in vitro mpt70/mpt83 expression and Rv0444c sequencing across M. tuberculosis complex (MTC) members revealed that high-level expression was associated with a mutated Rv0444c.
Protein Sequence
>Rv0444c, TB.seq 533092:533787 MW:23884 MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKP EVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNV APPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG
Human Homologue Blast Result
Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 9/82 (10%) Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 9/110 (8%)
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9UPX8 | 33 | 33 | 93 | 0.32 |
| sp|O14522 | 55 | 62 | 29 | 0.71 |
| sp|Q9BPW9 | 48 | 61 | 31 | 0.90 |
| sp|Q9UN74 | 29 | 42 | 82 | 1.8 |
| sp|P42226 | 25 | 40 | 110 | 2.0 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
INTEGRAL MEMBRANE PROTEIN
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
IEDB Analysis
Link to IEDB
Result Predicited by [4]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by []
IEDB Analysis
Link to IEDB
Result Predicted by [5]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by []
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by []
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
