Immunotation of Rv3918c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<Rv3918c> |image= | width=250 |image2= |Swiss Prot = Q1LVD4 | Genbank = | PDB = No structure available | DrugBank = | chemical_form...) |
|||
| Line 39: | Line 39: | ||
<tr><td>sp|Q5TAX3</td><td> 41</td><td> 50</td><td> 34</td><td> 1.5</td></tr></table> | <tr><td>sp|Q5TAX3</td><td> 41</td><td> 50</td><td> 34</td><td> 1.5</td></tr></table> | ||
| + | =Alergen Protein= | ||
| + | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
| + | Non Allergen Predicted by AlgPred Server | ||
Revision as of 07:15, 2 February 2010
| Immunotation of Rv3918c
| |
| Name | |
| <Rv3918c> | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 37516.7 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.2621 |
Contents |
General
Rv3918c, (MTV028.09c), len: 347. Unknown, similar to TR:O05189(EMBL:U87804) CHROMOSOME PARTITIONING PROTEIN PARA from CAULOBACTER CRESCENTUS (266 aa), fasta scores; opt:787 z-score: 990.9 E(): 0, 50.6% identity in 261 aa overlapand to SOJ_BACSU P37522 soj protein. bacillus subtilis. 11/95 (253aa),fasta scores; opt: 837 z-score: 1062.3 E(): 0,52.2% identity in 251 aa overlap. Possible alternative startsite at aa 107. Also similar to other M. tuberculosis proteins MTCI125.30 (E(): 4.3e-32, 35.2% identity in 327 aa overlap) and MTCY07D11.13 (E(): 3e-30, 39.9% identity in 263aaoverlap). Updated info: Functional Category: cell wall and cell processes. EC:
Protein Sequence
>Rv3918c, TB.seq 4406488:4407528 MW:37518 VSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPTMNVSRETSTEFDTPIGAAAERAMRVLHTTHEPLQR PGRRRVLTIANQKGGVGKTTTAVNIAAALAVQGLKTLVIDLDPQGNASTALGITDRQSGTPSSYEMLIGEVSLHTALRRS PHSERLFCIPATIDLAGAEIELVSMVARENRLRTALAALDNFDFDYVFVDCPPSLGLLTINALVAAPEVMIPIQCEYYAL EGVSQLMRNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVADEVRQYFGSKVLRTVIPRSVKVSEAPGYSMTIIDYDPG SRGAMSYLDASRELAERDRPPSAKGRP
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8TB37 | 27 | 42 | 280 | 5e-05 |
| sp|Q9Y5Y2 | 38 | 58 | 50 | 0.010 |
| sp|Q9H9Y4 | 25 | 35 | 129 | 0.34 |
| sp|Q8WXH0 | 26 | 44 | 99 | 0.99 |
| sp|Q5TAX3 | 41 | 50 | 34 | 1.5 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
